PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678450390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 676aa    MW: 74362.1 Da    PI: 7.046
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678450390genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.3e-095275592254
                SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 ryps +++  LA+++gL+++qV++WF N R +
  678450390 527 LRYPSDADKHLLARQTGLSKNQVSNWFINARVR 559
                48*****************************88 PP

2BELL81.79.8e-273524051871
       BELL  18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                +V++rY +y+eq+q++++s ++v+g g+a+pYtslA+ka+SrhFr+Lkdai++ 
  678450390 352 KVERRYGRYCEQMQMIVNSLDMVMGFGAAAPYTSLAQKAMSRHFRSLKDAISGE 405
                7**************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.4E-40286404IPR006563POX domain
PfamPF075262.3E-30292403IPR006563POX domain
Gene3DG3DSA:1.10.10.602.2E-22460479IPR009057Homeodomain-like
SMARTSM003891.9E-6508567IPR001356Homeobox domain
SuperFamilySSF466891.33E-12517570IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-22526569IPR009057Homeodomain-like
CDDcd000862.03E-9528564No hitNo description
PROSITE profilePS5007111.078528563IPR001356Homeobox domain
PfamPF059202.3E-12529559IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
RRKRWFLGDG SIRSRYSRGH TGFLSFFGCF GGLKFVLENL IEIFRLVKGE QELVRWRSDS  60
MSQEYHQGVY SFSRGRFERS GEEDNQIGRE KLRVSGFDAA PPQLHDGGSE FPVYETEGVS  120
LEMFNFASGG SAAATELLES QILHGYRNPG DGSAVDWFQP RDLTNQFLEP GKEQTNQISS  180
IDADSAAAMQ LFVINSQKQT SPPPSAAPSS TSSGQFPWFV NTASAAAGVV EGQGLSLSLS  240
SHRAEELRMG ESGMMFCGGV SPQYPFKTLS GGAGVSHTHG LPSPSYSSWN TVKKSKYGKA  300
ARELLEEFCT VGRGHMKRTK SVNQNAAVSS PPGKGALPQS STADRLEHQR RKVERRYGRY  360
CEQMQMIVNS LDMVMGFGAA APYTSLAQKA MSRHFRSLKD AISGELKRTC EALGEKEAPI  420
SGITKGETPR LRILEQNLRQ QKAIHQMGGG AYEHEAWRPQ RGLPERSVNI LRAWLFEHFL  480
NPQIGDNPDE FCVVSLDVIF FALKYAHGVV GRTVNESEVT VLCGLFLRYP SDADKHLLAR  540
QTGLSKNQVS NWFINARVRL WKPMVEEMYQ HEAKEKEEDD DDEEVDNEQS SSSGQTPMSV  600
TAFSHPHSSA PDPSPSPSML DAGKQRTASG DIEAKLMSFG MSGGGGSGDV SLTLGLRQAG  660
NTSDKSHLST RDFGGY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099269.11e-170PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-111BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLA0A022RUY31e-158A0A022RUY3_ERYGU; Uncharacterized protein
STRINGVIT_04s0023g01020.t011e-141(Vitis vinifera)
STRINGGLYMA11G06640.21e-142(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33412139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-105BEL1-like homeodomain 4